This is a working overview of Purity testing, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-12-12 and is reviewed periodically as new material appears.
Quality control for NAD+ materials typically combines identity, purity, and water content checks. Identity may be confirmed by ultraviolet spectrum, retention time in chromatography, or mass accuracy, while purity is assessed by HPLC peak area or quantitative nuclear magnetic resonance. Residual water and solvents can affect molar calculations and enzyme assays, so Karl Fischer titration or thermogravimetric analysis may be used. Commercial materials vary in grade and counterion form, and published methods should specify the exact salt or hydrate when reporting concentrations. Regulatory status depends on intended use, with research reagents, dietary ingredients, and clinical products treated under different frameworks.
Quantification of NAD+ in biological samples usually relies on separation techniques coupled to sensitive detection. High-performance liquid chromatography with ultraviolet detection can measure the oxidized form by its absorbance near 260 nm, while mass spectrometry provides greater specificity and can distinguish NAD+ from close analogs. Enzymatic cycling assays use coupled dehydrogenase reactions to amplify signal and estimate NAD+ concentrations in cell or tissue extracts. Because NAD+ and NADH interconvert rapidly, sample preparation must quench metabolism quickly and preserve the redox state before analysis.
The stability of NAD+ depends on pH, temperature, light exposure, and the presence of degradative enzymes. Aqueous solutions are generally more stable under mildly acidic to neutral conditions and degrade faster under alkaline conditions or prolonged heat. The solid is hygroscopic and should be stored desiccated, often frozen, and protected from repeated freeze-thaw cycles. In laboratory handling, aliquots reduce repeated temperature changes, and chelating agents may limit metal-catalyzed hydrolysis in some buffers. These practices matter because even small amounts of NADH or hydrolysis products can interfere with quantitative assays.
In aqueous solution, NAD+ is most stable under mildly acidic to neutral conditions and degrades faster at high pH or elevated temperature. The molecule can hydrolyze at the pyrophosphate bond or undergo nonenzymatic cyclization. Buffers, chelating agents, and cold temperatures slow these losses during analysis. Repeated freeze-thaw cycles are generally avoided because they can promote degradation and concentration changes. Light exposure is also controlled, though NAD+ is less photolabile than some related nucleotides.
Commercial NAD+ is supplied as a solid, often as the free acid or a salt, and purity is verified by chromatographic methods. Laboratories typically store it desiccated at minus 20 degrees Celsius or below. Working solutions are prepared fresh because even sterile aqueous solutions can lose activity over hours to days depending on pH and temperature. Documentation may include a certificate of analysis, an assay value, and a recommended retest date. Researchers should verify identity and purity when results depend on precise cofactor concentrations.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or lower | Desiccated; avoid repeated freeze-thaw cycles. |
| Typical analytical method | LC-MS or HPLC with UV detection | Absorbance at 260 nm used for concentration estimates. |
| Reduced form absorbance | 340 nm | NADH absorbs at 340 nm; NAD+ does not. |
| Aqueous stability | pH-dependent | Degradation increases with alkaline pH and heat. |
| Purity check | HPLC purity and UV spectrum | Identity confirmed by retention time and absorbance ratio. |
Measuring NAD+ in biological samples requires care because the molecule is chemically reactive and present at low concentrations in some tissues. Common approaches include enzymatic cycling assays, high-performance liquid chromatography, and liquid chromatography coupled to mass spectrometry. Each method has different sensitivity and specificity, and sample preparation can affect results. Acidic or alkaline extraction steps are used in some protocols, but the choice depends on the analyte and matrix. No single method is universally optimal for every tissue or fluid.
Solid NAD+ is relatively stable when kept dry, cold, and protected from light. Aqueous solutions are more vulnerable to hydrolysis and can lose activity during repeated freeze-thaw cycles or prolonged storage at ambient temperature. Stability depends on pH, ionic strength, and the presence of degrading enzymes or metal ions. For many laboratory uses, aliquots are stored frozen and thawed only once. Exact degradation rates vary by matrix, so stability should be checked for each application rather than assumed.
Beyond redox chemistry, NAD+ serves as a substrate for enzymes that transfer ADP-ribose or remove acetyl groups. Sirtuins, PARPs, and CD38-family enzymes consume NAD+ and produce nicotinamide and ADP-ribose-related products. These reactions link NAD+ availability to DNA repair, chromatin modification, and cellular signaling. Because the molecule is central to energy metabolism and regulation, changes in its concentration are studied in aging, immunity, and metabolic research. The balance between synthesis and consumption varies by tissue, developmental stage, and physiological state.
In humans, NAD+ can be synthesized from nicotinic acid, nicotinamide, nicotinamide riboside, and tryptophan through overlapping pathways. The salvage pathway recycles nicotinamide back to NAD+ and is often considered a major route in many tissues. Dietary precursors and intracellular recycling both contribute to the pool, but the quantitative importance of each source remains an active research question. NAD+ levels are not uniform across organs or cell compartments. Measurements in blood do not necessarily reflect concentrations inside tissues.
NAD+ is a dinucleotide composed of nicotinamide, ribose, and adenine linked by phosphate groups. Its full name is nicotinamide adenine dinucleotide, with "+" denoting the oxidized form. The molecule acts as a coenzyme in redox reactions, cycling between NAD+ and NADH. In cells, it participates in electron transfer during glycolysis, the citric acid cycle, and oxidative phosphorylation. It is distinct from NADP+, which carries an additional phosphate group and supports different biosynthetic reactions.
=== Available forms === Buprenorphine/naloxone is available in sublingual formulations (that is, products that are dissolved under the tongue). It is also available through monthly injection by healthcare provider. There is no evidence that the tablet formulation is easier to divert and use in ways other than intended by the prescriber compared to the film formulation, or that the tablet formulation has a higher risk for accidental ingestion by children. There are various pharmacokinetic differences between sublingual formulations.
== See also == Astronomical chronology Age of Earth Age of the universe Chronological dating, archaeological chronology Absolute dating Relative dating Phase (archaeology) Archaeological association Geochronology Closure temperature Geologic time scale Geological history of Earth Thermochronology List of geochronologic names General Consilience, evidence from independent, unrelated sources can "converge" on strong conclusions
The reinforcing effects of most addictive drugs depend on dopamine signaling in the nucleus accumbens, the same pathway that responds to natural rewards such as food and sex. Altered dopamine neurotransmission is frequently observed following the development of an addictive state. In people and in animals that have developed an addiction, altered dopamine or opioid neurotransmission is evident in the nucleus accumbens and elsewhere in the striatum.
== Epidemiology == The number of workers in the United States exposed to beryllium vary but has been estimated to be as high as 800,000 during the 1960s and 1970s. A more recent study from 2004 estimated the number of exposed workers in the United States to be around 134,000. The rate of workers becoming sensitized to beryllium varies based on genetics and exposure levels. In one study researchers found the prevalence of beryllium sensitization to range from 9–19% depending on the industry. Many workers who are found to be sensitive to beryllium also meet the diagnostic criteria for chronic beryllium disease. In one study of nuclear workers, among those who were sensitized to beryllium, 66% were found to have chronic beryllium disease as well. The rate of progression from beryllium sensitization to chronic beryllium disease has been estimated to be approximately 6–8% per year. Stopping exposure to beryllium in those sensitized has not been definitively shown to stop the progression to chronic beryllium disease. The overall prevalence of chronic beryllium disease among workers exposed to beryllium has ranged from 1–5% depending on industry and time period of study. The general population is unlikely to develop acute or chronic beryllium disease because ambient air levels of beryllium are normally very low (<0.03 ng/m3). However, a study found 1% of people living within 3/4 of a mile of a beryllium plant in Lorain, Ohio, had berylliosis after exposure to concentrations estimated to be less than 1 milligram per cubic metre of air.
Sources: en.wikipedia.org
The atomic radii of the alkali metals increase going down the group. Because of the shielding effect, when an atom has more than one electron shell, each electron feels electric repulsion from the other electrons as well as electric attraction from the nucleus. In the alkali metals, the outermost electron only feels a net charge of +1, as some of the nuclear charge (which is equal to the atomic number) is cancelled by the inner electrons; the number of inner electrons of an alkali metal is always one less than the nuclear charge. Therefore, the only factor which affects the atomic radius of the alkali metals is the number of electron shells. Since this number increases down the group, the atomic radius must also increase down the group. The ionic radii of the alkali metals are much smaller than their atomic radii. This is because the outermost electron of the alkali metals is in a different electron shell than the inner electrons, and thus when it is removed the resulting atom has one fewer electron shell and is smaller. Additionally, the effective nuclear charge has increased, and thus the electrons are attracted more strongly towards the nucleus and the ionic radius decreases.
The mevalonate pathway, also known as the isoprenoid pathway or HMG-CoA reductase pathway, is an essential metabolic pathway present in eukaryotes, archaea, and some bacteria. The pathway produces two five-carbon building blocks called isopentenyl pyrophosphate (IPP) and dimethylallyl pyrophosphate (DMAPP), which are used to make isoprenoids, a diverse class of over 30,000 biomolecules such as cholesterol, vitamin K, coenzyme Q10, and all steroid hormones. The mevalonate pathway begins with acetyl-CoA and ends with the production of IPP and DMAPP. It is best known as the target of statins, a class of cholesterol lowering drugs. Statins inhibit HMG-CoA reductase within the mevalonate pathway.
=== Religion and schools === In 2019, Schmitt spoke in defense of the Cameron R-1 School District after it came under criticism from the Freedom From Religion Foundation over a high school football coach who led students in prayer before and after games. The group contended that the practice violating the Establishment Clause of the First Amendment. In a letter, Schmitt called the foundation an "extreme anti-religion organization" and said he would support the coach, school, and school district if the group sued.
Sources: en.wikipedia.org
The palate is hard at the front of the mouth since the overlying mucosa is covering a plate of bone; it is softer and more pliable at the back being made of muscle and connective tissue, and it can move to swallow food and liquids. The soft palate ends at the uvula. The surface of the hard palate allows for the pressure needed in eating food, to leave the nasal passage clear. The opening between the lips is termed the oral fissure, and the opening into the throat is called the fauces. At either side of the soft palate are the palatoglossus muscles which also reach into regions of the tongue. These muscles raise the back of the tongue and also close both sides of the fauces to enable food to be swallowed. Mucus helps in the mastication of food in its ability to soften and collect the food in the formation of the bolus.
== See also == 3,4-Dihydroxyamphetamine (HHA; α-methyldopamine) 4-Hydroxy-3-methoxyamphetamine (HMA) 4-Hydroxy-3-methoxymethamphetamine (HMMA) 2,4,5-Trihydroxyamphetamine (THA) 2,4,5-Trihydroxymethamphetamine (THMA) 3,4-Dihydroxymethcathinone (HHMC) 4-Hydroxy-3-methoxymethcathinone (HMMC)
Bosentan inhibits endothelin-1 by blocking its action at the ETA and ETB receptors. Ambrisentan and sitaxsentan block endothelin-1 activity by selectively blocking the ETA receptor. Prostacyclins and prostacyclin agonists also cause vasodilation and also inhibit platelet aggregation. Epoprostenol, treprostinil and iloprost act as prostacyclin I2 (PGI2) analogues by binding to and activating the prostacyclin receptor to cause vasodilation. PGI2 activates adenylate cyclase to convert adenosine triphosphate (ATP) to cyclic adenosine monophosphate (cAMP), cAMP inhibits proliferation of smooth muscle cells in the pulmonary artery walls, and causes relaxation of smooth muscle cells thus acting as a vasodilator. Selexipag acts as a PGI2 receptor agonist to also activate adenylate cyclase. Epoprostenol and treprostinil are given as continuous intravenous infusions. Treprostinil is also available as an inhaled form, as is iloprost. In those who have a sustained vasodilator response as determined during the right heart catheterization (approximately 10% of those with PAH are responders), long acting calcium channel blockers nifedipine, diltiazem or amlodipine are indicated. In disease that is refractory to medical therapy, an atrial septostomy may be used palliatively or as a bridge to lung transplantation.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Sources: en.wikipedia.org
Common methods include LC-MS, HPLC with UV detection, and enzymatic cycling assays. Rapid quenching is needed because NAD+ and NADH interconvert. The chosen method should be validated for the sample matrix.
Solid NAD+ is typically stored desiccated at -20 °C or lower. Aqueous solutions are less stable and should be prepared fresh or frozen in aliquots. Repeated freeze-thaw cycles can reduce integrity.
NADH, NAD+ analogs, hydrolysis products, and residual solvents can interfere. Buffer pH and metal ions may also affect stability or enzyme activity. Blank controls and calibration curves help identify such problems.
NAD+ and NADH can interconvert quickly after a sample is collected, which can alter the measured ratio. Rapid quenching and cold handling limit enzymatic and chemical changes.